SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028829 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028829
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily SAP domain 6.41e-21
Family SAP domain 0.0000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028829   Gene: ENSBTAG00000021634   Transcript: ENSBTAT00000028829
Sequence length 628
Comment pep:known chromosome:UMD3.1:3:21612696:21622086:1 gene:ENSBTAG00000021634 transcript:ENSBTAT00000028829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEIYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSESKKKVEVIDLTVESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLTPTLGSSHRSATPAPPPGRVSSIVAPG
GTLREGHGGPLPSGPSLTGCRSDIISLD
Download sequence
Identical sequences A6QQU9
ENSBTAP00000028829 NP_001095655.1.59421 NP_001095655.1.76553 XP_005898574.1.15283 XP_006051180.1.26621 XP_012013774.2.54773 XP_017901499.1.57651 XP_019812225.1.53367 ENSBTAP00000028829 9913.ENSBTAP00000028829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]