SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028855 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028855
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.31e-31
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 2 Region: 201-280
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.29e-30
Family GAS2 domain 0.00000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028855   Gene: ENSBTAG00000021654   Transcript: ENSBTAT00000028855
Sequence length 313
Comment pep:known chromosome:UMD3.1:29:22275086:22423775:-1 gene:ENSBTAG00000021654 transcript:ENSBTAT00000028855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEK
LDNGALLCQLAETVQEKFKESMDTTKPTKNLPLKKIPCKASAPSGSFFARDNTANFLSWC
RDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLS
APSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPSKFCVERLSQGRYRVGEKILFI
RMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPVQSKSPTLKDMNPDNYL
VVSASYKAKKEIK
Download sequence
Identical sequences A8E4Q5 L8ISN9
NP_001098471.1.59421 NP_001098471.1.76553 XP_005226789.1.76553 XP_005226790.1.76553 XP_005891330.1.15283 ENSBTAP00000028855 ENSBTAP00000028855 9913.ENSBTAP00000028855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]