SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028994 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028994
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.19e-33
Family Chaperone J-domain 0.0000451
Further Details:      
 
Domain Number 2 Region: 243-330
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 8.24e-24
Family HSP40/DnaJ peptide-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 159-241
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.14e-16
Family HSP40/DnaJ peptide-binding domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028994   Gene: ENSBTAG00000021752   Transcript: ENSBTAT00000028994
Sequence length 337
Comment pep:known chromosome:UMD3.1:3:66923000:66931737:-1 gene:ENSBTAG00000021752 transcript:ENSBTAT00000028994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDYYCILGIEKGASDEDIKKAYRKQALRFHPDKNKSPQAEERFKEVAEAYEVLSDPKK
REIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGR
DSDEMEVDGDPFGAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMK
ISRKRLNPDGRSYRTEDKILTIEIKKGWKEGTKITFPREGDETPTSIPADIVFVIKDKDH
PKFKRDGSNIIYTAKISLREALCGCSINVPTMDGRTIPMTINDIVKPGMRRRIIGYGLPF
PKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS
Download sequence
Identical sequences Q2KIT4
ENSBTAP00000028994 NP_001039968.1.59421 NP_001039968.1.76553 XP_019812791.1.53367 ENSBTAP00000028994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]