SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028997 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028997
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-31
Family Dual specificity phosphatase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028997   Gene: ENSBTAG00000021754   Transcript: ENSBTAT00000028997
Sequence length 345
Comment pep:known_by_projection chromosome:UMD3.1:3:7849647:7857668:-1 gene:ENSBTAG00000021754 transcript:ENSBTAT00000028997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAQEGSHGWEHQIGSQSRASSARHMLEVRPGLFLGGAAAVAEPDHLREAAVTAVLTVD
SEEPNFKTGAGVEGLRSLFVPALDKPETDLLSHLDRCVAFIVQARAEGRAVLVHCHSGVS
RSVTVITAFMMKTDQLTFEEAYENLKTVKPEAKMNEGFEWQLKLYQAMGCEVDTSSAVYK
QYRLQKVTEKYPELQNLPQELFAVDPSAISQGLKDGGLYKCRKCRRSLFRSSSVLDHNEG
SGPIAFAHKRMTASPMLSAGSQAQCTSYFIEPVQWMESTLLGVMDGQLLCPKCNAKLGSF
NWYGEQCSCGRWIAPAFQIHKSRVDETKTLPMWGSQTRETGTRYM
Download sequence
Identical sequences F1MW70
9913.ENSBTAP00000028997 ENSBTAP00000028997 ENSBTAP00000028997 XP_002685893.1.76553 XP_581568.3.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]