SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029135 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029135
Domain Number 1 Region: 1-290
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.32e-41
Family Bacterial PLC 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029135   Gene: ENSBTAG00000035122   Transcript: ENSBTAT00000029135
Sequence length 295
Comment pep:novel chromosome:UMD3.1:X:143653392:143661756:1 gene:ENSBTAG00000035122 transcript:ENSBTAT00000029135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMPLHHLSIPGSHSMMTYCLNKKSPISHKESRLLQTLGKVLPCVTLPVVLKRSTTQTFQC
AEHREAPAHRGCWREDLQMAHMEEGTERNLHSGHMVYMTALTEDMLTEISEWLENHPQEV
VILACRNFKGVMEDLHEYLMGCIKNIFGDMLCPMGEMLTLHQLWSQGQQVILSYKDEASV
SQHAELWPGIPYWWGNQVKPRDLVHHLELMKSCSHPGRLMVAGINLSENLEFVRVHPAWS
LEKLTQWGLPYLCAWVRGQCPGSATGRTNTVAGEFIWADGFVGDVIGLNWKLLGA
Download sequence
Identical sequences F1MHG7
ENSBTAP00000029135 ENSBTAP00000029135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]