SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029159 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029159
Domain Number 1 Region: 54-463
Classification Level Classification E-value
Superfamily Ras GEF 1.7e-101
Family Ras GEF 0.00039
Further Details:      
 
Domain Number 2 Region: 524-592
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 458-529
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000762
Family Calmodulin-like 0.033
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000029159
Domain Number - Region: 747-784
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0628
Family Mitotic arrest deficient-like 1, Mad1 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029159   Gene: ENSBTAG00000021872   Transcript: ENSBTAT00000029159
Sequence length 797
Comment pep:known_by_projection chromosome:UMD3.1:10:34202006:34280992:-1 gene:ENSBTAG00000021872 transcript:ENSBTAT00000029159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLGKAREAPRKPTHGCRAVPKARLEAKPASSPLPCHPGLAQITQFRMMVPLGHFAKGA
SLDDLIDSCVQSFDADGNLCRSNQLLQVMLTMHRILISSAELLQKVITLYPDALAKNSPG
LCLKICYFVRYWITEFWIMFKMDTSLASTMEEFQELVKANGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTFLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEEGKVNVHKLLALYNHINELVQLQEVPPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHKAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNSTA
PTEISTSVGPTSNLCSLGAKDLLHAPEEGPFTFPNGEAAEHSEESKDRTIMLMGVSSQKI
SVRLKRTVAHMATQTEALSWPGSEGPSSHFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKESFIKSKEELRHLRLPTYQELEQEINTLKADNNALKIQLKYAQKKIETLQ
LARNNHVLAQMEQGDCS
Download sequence
Identical sequences E1BG59
9913.ENSBTAP00000029159 ENSBTAP00000029159 ENSBTAP00000029159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]