SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029198 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029198
Domain Number 1 Region: 1233-1498
Classification Level Classification E-value
Superfamily Nudix 5.78e-41
Family MutT-like 0.0000317
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000029198
Domain Number - Region: 203-253,306-367
Classification Level Classification E-value
Superfamily MCP/YpsA-like 0.00114
Family MoCo carrier protein-like 0.01
Further Details:      
 
Domain Number - Region: 460-521
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0942
Family Pseudo ankyrin repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029198   Gene: ENSBTAG00000021901   Transcript: ENSBTAT00000029198
Sequence length 1499
Comment pep:known_by_projection chromosome:UMD3.1:1:145830610:145871792:1 gene:ENSBTAG00000021901 transcript:ENSBTAT00000029198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLAKRHRDQASSGEEDSFGVQPRRVADLAMVPNLRWSSTGLCRRTRSQCLFSSCEKQG
DLSSWISDNIKKKECIYFVESSKLSDAGKVVCECGYPREQHLEEATGSHTFQGQEWDPKK
HVREMPTDAFGDIVFTGLGQKVGKYVRLSQDTPSSLIYQLMTQQWGLDAPNLLISVTGGA
KDFKMKPRLKSIFRRGLLKVAQTSGAWVITGGSHTGVMKQVGEAVRNFSLSGSFCEGEVV
TIGIATWGALHNRESLIHPTGGFPAEYIMDEGGQGHLTCLDSNHSHFILVDDGTHGRYGV
EIPLRTKLEKFISQQTKERGGVAIKIPIVCVVLEGGPGTLNTIYNAITNGTPCVVVEGSG
RVADVIAQVAGLPISEITISLIQQKLSMFFQGMFETFTESKIVEWTKKIQDIVRRRQLLT
VFREGKDGQQDVDVAILQALLKASRSLDHFGHENWDHQLNLAVAWNRVDIAQSEIFTDER
QWKPSELYPMMVAALITNKPEFVKLFLENGVQLKEFISQATLFYLYQNLEPTCLFHCKLD
RVLGGEPERLDPGVLLQRVAQVLRELLGDSTQLLYSRPHSSDQQRLFTVPSVKISVQGVN
PQSSYKHSSSQATFTIDPVRDLLIWAIVQNRRELAEIIWAQSQDCIAAALACSKILKELS
KEEEDTDSLEEMLVLADEYEQRAIGVFTECYRQNEERAQKLLVRVSEAWGRTTCLQLALE
AKDMKFVSHGGIQAYLTKVWWGQLSVDNGLWRLVLCMLVFPLLYTGLVSFRNRELQADRC
LARVRAFFSAPVVVFHMNILSYFAFLCLFAYVLMVDFQPQPSSCECLIYVWLFSLVCEEL
RQLFYDPDGSGLRKAVLVYFSDYWNKLDVCAILLFIAGLTCRLMPSLLYTGRIILSLDFT
MFCLRLMHIFTVSKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVE
WIFRGAIYHSYLTIFGQLPTYIDGVNFKPDQCSPNGTDPYKPKCPEIDQARQEPVFPEWL
TVLLLCLYLLFANILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYQGRPPAPPPF
ILLSHLHLIIKRVVLKIPAKRHKLFKNKLEKTEEAALLSWEMYLKENYLQEQQFQQKQRP
EQKIQDVSDKVDSMVRLLEMAHLKQSGAMEQRLASLEEQVAQTATALHWIVKALRDSGFG
SEEGVPTLAPQKASVGRDPELDSRSKAEDPDDAYHVNARHLLYPSCSVLRFPVPNEKVPW
ETEFLMYNPPFYTANRKDKDLVDPVGDALEPLSRISYNAVDGPLDRRSFHGVYTVRDGLP
LNPMGRTGLRGRGDLSRFGPNHTLQPVITRWRRSLDGAICRKNVKKMLEVLVVKHGPSEH
WMLPGGSREPGELLPQNLKQVLQREFWSSFERLLTQGMKVYKGYMDDPRNTDNAWIETVA
VSIHFPDQSDVELKRLNSHLHSCDEGMAIRWQVVDERIPLYDNHKVILQKVAALFMAYY
Download sequence
Identical sequences E1BFK7
9913.ENSBTAP00000029198 ENSBTAP00000029198 XP_010799963.1.76553 XP_010822777.1.59421 ENSBTAP00000029198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]