SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029212 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029212
Domain Number 1 Region: 205-353
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-42
Family Dual specificity phosphatase-like 0.000000454
Further Details:      
 
Domain Number 2 Region: 19-155
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.57e-28
Family Cell cycle control phosphatase, catalytic domain 0.00000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029212   Gene: ENSBTAG00000021912   Transcript: ENSBTAT00000029212
Sequence length 386
Comment pep:known chromosome:UMD3.1:22:49379908:49385352:1 gene:ENSBTAG00000021912 transcript:ENSBTAT00000029212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSGSGAGTGADAAAGAGAMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIETAIN
LAIPGLMLRRLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASV
LGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSGSPPTSVLGLGGLRIS
SDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKY
ILNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLA
GISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDN
HTPSEQLYFSTPTNHNLFPLNTLEST
Download sequence
Identical sequences F1MFJ5
ENSBTAP00000029212 ENSBTAP00000029212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]