SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029273 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029273
Domain Number 1 Region: 21-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.47e-62
Family Eukaryotic proteases 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029273   Gene: ENSBTAG00000021958   Transcript: ENSBTAT00000029273
Sequence length 258
Comment pep:known chromosome:UMD3.1:20:24033747:24042721:-1 gene:ENSBTAG00000021958 transcript:ENSBTAT00000029273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNSSTFLAATLSIVVFLLIPEDLCEKIIGGNQVTPHSRPYMVLLDGGNICAGALIAKDW
VLTAAHCSLNQKSQIILGAHSRNKEEPEKQIMFVKKEFPYPCYDPDTHEGDLKLLKLNKK
ATLNKNVAILQLPKEGKDVEPGTACRVAGWGQFYNNSPVSILREVIVTIIDRKICNDQSH
YNNPVIGLNMICAGSLQGGKDSCPLGDSGSPLICKDTFRGITAFGIPGRCGDPRGPGVYT
LLSKKHLNWIVKTMKQAV
Download sequence
Identical sequences F6QZF5
ENSBTAP00000029273 ENSBTAP00000029273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]