SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029307 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029307
Domain Number 1 Region: 4-169,215-324
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.08e-48
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029307   Gene: ENSBTAG00000021978   Transcript: ENSBTAT00000029307
Sequence length 327
Comment pep:known chromosome:UMD3.1:5:115517820:115572329:1 gene:ENSBTAG00000021978 transcript:ENSBTAT00000029307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSDLQEEGKNAINSPMCPAPVEVHPEDSLLEENEERTVIDPTSRDDPRFKELVKVLIDWI
NDVLVEERIIVKQLEEDLYDGQVLQKLLEKLADCKLNVAEVTQSEIGQKQKLQTVLEAVQ
ELLRPHSRPLQWTVDSIHGKNLVAILHLLVALAMHFRAPIHLPEHVSVQVVVVRKREGLL
HSSHVTEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTE
LETQFADGVYLVLLMGLLEDYFVPLHNFYLTPDSFDQKVHNVSFAFELMLDGGLKKPKAR
PEDVVNLDLKSTLRVLYNLFTKYKHLE
Download sequence
Identical sequences F1MC75
ENSBTAP00000029307 9913.ENSBTAP00000029307 ENSBTAP00000029307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]