SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029320 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029320
Domain Number 1 Region: 275-383
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 387-427
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000327
Family SOCS box-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029320   Gene: ENSBTAG00000021988   Transcript: ENSBTAT00000029320
Sequence length 440
Comment pep:known chromosome:UMD3.1:10:67735433:67749358:1 gene:ENSBTAG00000021988 transcript:ENSBTAT00000029320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSESNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVSAIEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPISPKSDEWVSTDLSQSELRDGQLKQRR
NMEEVSCFSHTSVQPCVITSNNSSGRGGPGTDSIVNLASNNSIEDSDMDSDDEIITLCTS
SRKRNKPKWEIDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
Download sequence
Identical sequences Q0VC91
ENSBTAP00000029320 NP_001069686.1.59421 NP_001069686.1.76553 XP_006064930.1.26621 XP_019824514.1.53367 ENSBTAP00000029320 9913.ENSBTAP00000029320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]