SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029333 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029333
Domain Number 1 Region: 1213-1434
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-63
Family DBL homology domain (DH-domain) 0.00000000275
Further Details:      
 
Domain Number 2 Region: 1437-1575
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-32
Family Pleckstrin-homology domain (PH domain) 0.000000243
Further Details:      
 
Domain Number 3 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 4.56e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 1589-1709
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-26
Family PLC-like (P variant) 0.011
Further Details:      
 
Domain Number 5 Region: 1140-1214
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-26
Family SH3-domain 0.0000608
Further Details:      
 
Domain Number 6 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 1.84e-22
Family Eps15 homology domain (EH domain) 0.0015
Further Details:      
 
Domain Number 7 Region: 740-814
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-20
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 8 Region: 908-972
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 9 Region: 992-1055
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-19
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 10 Region: 1069-1137
Classification Level Classification E-value
Superfamily SH3-domain 1.12e-17
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029333   Gene: ENSBTAG00000021997   Transcript: ENSBTAT00000029333
Sequence length 1716
Comment pep:known_by_projection chromosome:UMD3.1:1:944294:1188287:-1 gene:ENSBTAG00000021997 transcript:ENSBTAT00000029333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGNWIEKLFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGI
ASMPPLTAVAPVPMGSIPVVGMSPPLVSSVPAAGVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPTAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVITSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHNKQQLQKQKSIEAERLKQKEQERKILELEKQKEEAQRRAQERDQQW
LERVHQEDEQQRPRKPHEEEKLKREESVKKKDSEEKGKPEMQDKLSRLFHQHQEPAKPAV
QAPWSTAEKGPLTISAQENIKVVYYRALYPFESRSHDEITIQPGDIVMVDESQTGEPGWL
GGELKGKTGWFPANYAEKIPENEVPAPVKPVTEAASTPTPKVAVCETPAPSSTTPAEPSE
TPNNWADFSSTWPTSTNEKPETDSWDAWATQPSLTVPSAGQLRQRSAFTPATATGSSPSP
VLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSY
VKLISGPIRKSTSMDSGPSESPASLKRVASPAAKPAVSGEEFIAMYTYESSEQGDLTFQQ
GDVILVTKKDGDWWTGTVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASY
TATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITP
TDPPKPTAFPTVCQVIGMYDYTAQNDDELAFSKGQVINVLNKEDPDWWKGEVHGQVGLFP
SNYVKLTTDTDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQK
PLMESELLTEKEGAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILTAQLPH
MQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRY
PLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVLCEGL
SEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSGTDKVF
SPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQK
IKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM
GSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADI
KKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences E1BKY4
ENSBTAP00000029333 ENSBTAP00000029333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]