SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029334 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029334
Domain Number 1 Region: 1172-1394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-62
Family DBL homology domain (DH-domain) 0.0000000251
Further Details:      
 
Domain Number 2 Region: 1393-1535
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-30
Family Pleckstrin-homology domain (PH domain) 0.00000148
Further Details:      
 
Domain Number 3 Region: 230-332
Classification Level Classification E-value
Superfamily EF-hand 3.27e-27
Family Eps15 homology domain (EH domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 1086-1169
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-27
Family SH3-domain 0.0000047
Further Details:      
 
Domain Number 5 Region: 1549-1669
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.36e-27
Family PLC-like (P variant) 0.0043
Further Details:      
 
Domain Number 6 Region: 11-106
Classification Level Classification E-value
Superfamily EF-hand 1.49e-25
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 7 Region: 742-815
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-20
Family SH3-domain 0.0000389
Further Details:      
 
Domain Number 8 Region: 951-1020
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-19
Family SH3-domain 0.0000354
Further Details:      
 
Domain Number 9 Region: 851-940
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-19
Family SH3-domain 0.0000172
Further Details:      
 
Domain Number 10 Region: 1030-1101
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029334   Gene: ENSBTAG00000023172   Transcript: ENSBTAT00000029334
Sequence length 1679
Comment pep:known_by_projection chromosome:UMD3.1:11:74895799:74982112:1 gene:ENSBTAG00000023172 transcript:ENSBTAT00000029334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KASGPYLVLGGPNMWAITSEERTKHDKQFDNLKPSGGYITGDQARTFFLQSGLPAPVLAE
IWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMGS
MPNLSIPQSLPPVAPIAPPLSSATSGTTLPSLLMAAPLVPSISTSSLPNGTVSLIQPLSI
PYSSSTLPHTSSYSLMIGGFGGANIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAV
PQPSRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADIDGDGQLKAE
EFILAMHLTDMAKAGQPLPLALPPELVPPSFRGGKQIDSINGTLPSYQKAQEEEPQKKLP
VTFEDKRKANYERGNMELEKRRQAMMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL
ELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLSRRNREQEE
IVRLNSKKKSLHLELEALNGKHQQISGRLQDVRLRKQTQKTELEVLDKQCDLEIMEIKQL
QQELQEYQNKLIYLVPEKQLLNERIKNMQLGNTPDLGISLLQKKSLEKEELCQRLKEQLD
ALEKETASKLSEMDSFNNELKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRESYNTQQLA
IEQLYKIKRDKLREIERKRSELIQKKKLEDEATRKAKQGKENLWKENLRKEEEEKQKRLQ
EEKAQEKVQEVERKAEEKQSEPAGTLVNYRALYRFEARNHDEMSFNSGDIIQVDEKTVGE
PGWLYGSFQGNFGWFPGNYVEKVTSSEKSVSPKKALLPPTVSATSTSESLSSNQPASVID
YRNVSFSNLSVNTSWQKKSAFTRTVSPVSVSPIHGQGQVVENLKAQALCSWTAKKENHLN
FSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREEPEALYASVNKKPASA
ACTVGEEYIALYSYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRTGIFPSNYVKPKD
QEGFGSSSKSGTSNKKPEIAQVTSAYAASGSEQLSLAPGQLILILKKNTSGWWQGELQAR
GKKRQKGWFPASHVKLLGPSSERTAPAFHPVCQVIAMYDYTANNEDELSFSKGQLINVLN
KDDPDWWQGETSGVTGLFPSNYVKMTTDADPSQQWCADLQTLDTMQPVERKRQGYIHELI
ETEERYVDDLQLVVEVFQKRITEPGFLAEGEMALIFVNWKELIMANTKLLKALRVRKKTG
GEKMPVHMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEHADFKEFLKKLASDPRC
KGMPLSSFLLKPMQRITRYPLLIRSILENTPENHVDHSSLKLALERAEELCSQVNEGVRE
KENSDRLEWIQTHVQCDGLAEQLVFNSLTNCLGPRKLLHSGKLYKTKSNKELHGFLFNDF
LLLTYMVKQFAVSSASEKLFSSKSSAQFKMYKTPIFLNEALVKLPTDPSSDEPVFHISHI
DRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQARSQKSSGIGRLMVHVIEA
TELKACKPNGKSNPYCEISMGSQSYTTRTLQDTLNPKWNFNCQFFIKDLYQDVLCLTMFD
RDQFSPDDFLGRTEVPVAKIRTEQESKGPTTRRLLLHEVPTGEVWVRFDLQLFEQKTLL
Download sequence
Identical sequences F1MC50
ENSBTAP00000029334 ENSBTAP00000029334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]