SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029348 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029348
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.78e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1018-1126
Classification Level Classification E-value
Superfamily E set domains 3.89e-35
Family Filamin repeat (rod domain) 0.000000931
Further Details:      
 
Domain Number 3 Region: 1306-1417
Classification Level Classification E-value
Superfamily E set domains 5.34e-35
Family Filamin repeat (rod domain) 0.00000266
Further Details:      
 
Domain Number 4 Region: 1216-1326
Classification Level Classification E-value
Superfamily E set domains 1.33e-31
Family Filamin repeat (rod domain) 0.000000968
Further Details:      
 
Domain Number 5 Region: 1398-1461,1493-1546
Classification Level Classification E-value
Superfamily E set domains 2.92e-31
Family Filamin repeat (rod domain) 0.00000686
Further Details:      
 
Domain Number 6 Region: 1623-1738
Classification Level Classification E-value
Superfamily E set domains 6.67e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 7 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 1.75e-29
Family Filamin repeat (rod domain) 0.00043
Further Details:      
 
Domain Number 8 Region: 1536-1641
Classification Level Classification E-value
Superfamily E set domains 2.67e-29
Family Filamin repeat (rod domain) 0.0000238
Further Details:      
 
Domain Number 9 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 5.23e-29
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 10 Region: 1849-1943
Classification Level Classification E-value
Superfamily E set domains 2.67e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 11 Region: 2018-2124
Classification Level Classification E-value
Superfamily E set domains 1.07e-27
Family Filamin repeat (rod domain) 0.00000341
Further Details:      
 
Domain Number 12 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Filamin repeat (rod domain) 0.00000461
Further Details:      
 
Domain Number 13 Region: 643-753
Classification Level Classification E-value
Superfamily E set domains 2.04e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 14 Region: 252-365
Classification Level Classification E-value
Superfamily E set domains 4.2e-27
Family Filamin repeat (rod domain) 0.00091
Further Details:      
 
Domain Number 15 Region: 2219-2315
Classification Level Classification E-value
Superfamily E set domains 4.6e-27
Family Filamin repeat (rod domain) 0.00000947
Further Details:      
 
Domain Number 16 Region: 536-639
Classification Level Classification E-value
Superfamily E set domains 2.54e-26
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 17 Region: 350-448
Classification Level Classification E-value
Superfamily E set domains 2.39e-24
Family Filamin repeat (rod domain) 0.00095
Further Details:      
 
Domain Number 18 Region: 2542-2632
Classification Level Classification E-value
Superfamily E set domains 2.4e-24
Family Filamin repeat (rod domain) 0.0000173
Further Details:      
 
Domain Number 19 Region: 2320-2411
Classification Level Classification E-value
Superfamily E set domains 8.67e-24
Family Filamin repeat (rod domain) 0.0000172
Further Details:      
 
Domain Number 20 Region: 2413-2504
Classification Level Classification E-value
Superfamily E set domains 1.13e-23
Family Filamin repeat (rod domain) 0.0000155
Further Details:      
 
Domain Number 21 Region: 741-841
Classification Level Classification E-value
Superfamily E set domains 4.12e-23
Family Filamin repeat (rod domain) 0.00054
Further Details:      
 
Domain Number 22 Region: 2141-2236
Classification Level Classification E-value
Superfamily E set domains 7.34e-21
Family Filamin repeat (rod domain) 0.0000114
Further Details:      
 
Domain Number 23 Region: 1938-2027
Classification Level Classification E-value
Superfamily E set domains 2.94e-18
Family Filamin repeat (rod domain) 0.00000491
Further Details:      
 
Domain Number 24 Region: 947-1034
Classification Level Classification E-value
Superfamily E set domains 2.8e-17
Family Filamin repeat (rod domain) 0.0031
Further Details:      
 
Domain Number 25 Region: 1776-1850
Classification Level Classification E-value
Superfamily E set domains 6.07e-16
Family Filamin repeat (rod domain) 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029348   Gene: ENSBTAG00000022004   Transcript: ENSBTAT00000029348
Sequence length 2633
Comment pep:known_by_projection chromosome:UMD3.1:22:43674720:43815706:-1 gene:ENSBTAG00000022004 transcript:ENSBTAT00000029348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
HMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEALVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEVASNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDRGNQVYRCVYKP
MQPGPHVVKVSFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGIRIRETADFKVDTK
AAGSGELGVTIKGPKGLEELVKQKGFQDGVYAFEYYPSTQGKYSVSITWGGHHIQKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPFMAYIHPASGDYNPDLVQAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGDGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVSIGQGSHPQKVKVFGPGVERSGLKAHEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDEEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPTSPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFSSPGPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSRIKINGLENRVEVGK
DQEFAVDTRGAGGQGKLDVTILSPSRKVVPCLVAPMAGREGSTAKFIPREEGLYAIDLTY
DGHPVPGSPYVVEASLPPDPTKVKAHGPGLRGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGLLSVDCSEAGPGTLGLEAVSDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPVPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYVPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIVGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVMGPRADQTISWSRRSPLKAISGFFKRDRKGDFMETGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLST
YGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
AAVKEVPVNACPPGFRPWVTEEAYVPVSNMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTAKPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSDM
SAHVTSPSGRVTEAEIVPVGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYVVPVIAPSDDARRLTVLSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGAGLEGGSTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFLGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences E1BKX7
NP_001178389.1.59421 NP_001178389.1.76553 ENSBTAP00000029348 ENSBTAP00000029348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]