SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029404 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029404
Domain Number 1 Region: 722-779
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 29-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000314
Family Somatomedin B domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000029404
Domain Number - Region: 64-136
Classification Level Classification E-value
Superfamily E set domains 0.000686
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029404   Gene: ENSBTAG00000006730   Transcript: ENSBTAT00000029404
Sequence length 821
Comment pep:known chromosome:UMD3.1:17:73408384:73415618:1 gene:ENSBTAG00000006730 transcript:ENSBTAT00000029404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPTLLPWALLLLATVPGPDLWPAAGAQLSCSQRCGDQSGPCSCHPTCFGLASCCVDIRD
FCLEISPYSGSMMGGKDFVVRHLNWPNPADSVICSFKESIQTHGYVDASGRVHCVSPLLY
ESGRIPFTLSMNNGRSFPRSGTWLSVHPSKVSDSEKSQLVNETRWQYYGTPGTQGNLTLT
WNTSALPSDTVTIELWGYEETGKPYSQQWAAAWSYLYSLATNIHNSGSFTFTPKPAPQNF
QRWEVGSLRIVDSRHSAGKPDVQAIWSNEHALAWHLGEDFRMDPVAWARNQCLAWEELED
QLPTFLEELPDCPCTLAQARADSGRFHTDYGCDLEQGSVCTYHPGAVHCVRSVQASPRYY
SGQQCCYTADGTQLLTADSTGGSTPDRGHDWGSPPYRVPPRVPGLSHWIYDVISFYHCCL
WAPECFRYMNRRPSSDCRSYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAALTDL
RVQARTQTRVTPEGSQDRGTGLTAVAVQEANSDVVEVRLGDGAGVLQVLLNQEVLSFAEQ
RWMDLKGMFLSVAAGNRVSVMLTSEAGLEISLQGPFLSVAVLLPEKFLTHTQGLLGTFNN
DPADDFTLRSGEVLPPSASSRELFRFGADWAVQNASSLLTYDSKFLVENFKERPKHDPTF
LPLFPEESSASPSQASAAADLCGDDSFCKFDVAATGSLSVGNASRVAHMQHRLRVQSLQP
VVSCGWLAPPANGHKQGERYLVGSTVRFRCNNGYSLAGADASTCQADGTWSWPTPTCQPG
RSYAVLLGIIFGGLGLVALVGLGYWLLRRRKSNTAVWGSQP
Download sequence
Identical sequences F1MSE7
ENSBTAP00000029404 9913.ENSBTAP00000029404 ENSBTAP00000029404 NP_001192604.1.59421 NP_001192604.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]