SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029616 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029616
Domain Number 1 Region: 201-326
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-31
Family Pleckstrin-homology domain (PH domain) 0.00049
Further Details:      
 
Domain Number 2 Region: 381-481
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.0000319
Further Details:      
 
Domain Number 3 Region: 28-88
Classification Level Classification E-value
Superfamily Phenylalanine zipper 7.98e-22
Family Adapter protein APS, dimerisation domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029616   Gene: ENSBTAG00000009101   Transcript: ENSBTAT00000029618
Sequence length 586
Comment pep:known_by_projection chromosome:UMD3.1:17:57398014:57422729:1 gene:ENSBTAG00000009101 transcript:ENSBTAT00000029618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPTLQSSSASSASSASTSAAAAPSPRGWSEFCELHAVAAARELARQYWLFAREHPHHA
PLRAELVSLQFTDLFQRYFCREVREGRAPGPPAPRAAPAAPARDYRETGRGSPAKAEAAP
AEQGAGPGPAAPAPAPGLPKARSSKELAPPRPAATCSLRHLRHSLRHIFRHRSAGELPAG
PVATNGEAGEAPARPGLARKLLPWSLAREPPPEALKEATLRYSLADEASMDSGARWQRGR
LALRRTGPDGADRLLELFDPPKSSKSKLQAACSSIQEIRRCTRLEMPDNLYTFVLKVKDR
TDIIFEVGDEQQLNSWMAELRACTGQGLETTDPEPHFPSATEPVGTADSPRGSTDSLNQG
GSPGGLLDPACQKTDHFLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEY
VLTFNFQGIAKHLRLSLTERGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSY
VVVVSQPPGSSNTVLFPFSLSRWDSELGLPHLSTSGCPRGLGPEGLPGRSSPPEQIFHLV
PSPEELANSLRHLEPEPASRARDSDYEMDSSSRSRLRAIDNQYTPL
Download sequence
Identical sequences E1BE90
ENSBTAP00000029616 ENSBTAP00000029616 9913.ENSBTAP00000029616 NP_001179996.1.59421 NP_001179996.1.76553 XP_005217968.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]