SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029786 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029786
Domain Number 1 Region: 447-620
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0029
Further Details:      
 
Domain Number 2 Region: 602-699
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-19
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 3 Region: 767-893
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000456
Family Calmodulin-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029786   Gene: ENSBTAG00000018951   Transcript: ENSBTAT00000029790
Sequence length 1226
Comment pep:known_by_projection chromosome:UMD3.1:17:17374260:17443063:1 gene:ENSBTAG00000018951 transcript:ENSBTAT00000029790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLLVGTLDVVLDSSARVAPYRILYQTPDSLVYWTIACVGKQCTDTFHWEVWKLPSFLSL
LLLFNVSLDVSRYVRALLQGIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLV
NYYSCSYWKGKVPRQGWMYLSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVI
KVSTRSSEHFFSVFLNINETFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKKKSPKKVSA
LKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKE
ENLCSLIIPLREVTIVEKADSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQ
TTSKIYSDKEFAGSYNSSDDEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQ
TLMTMYRRRSPEEFNPKLAKEFLKEQAWKIHFAEYGQGVCMYRTEKTRELVLKGVPESMR
GELWLLLSGAINEKATHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIA
ALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVG
ALVDQGVFEELARDYVPQLYDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFYE
GIKVIFQLALAVLDANVDKLLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDD
VEPYPEVDIFRLIRTSYEKFGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETS
FTTDELEELYALFKAEHLTSCYWGGNSNALDRHDPSLPYLEQYRIDLEQFKGMFALLFPW
ACGTHSDVLASRLFQLLDENGDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLPEPSS
DQDEPDSAFEATQYFFEDITPECTHVVGLESRNKHSADDGFVTVSLKPDRGKRANSQENR
SYLRLWTPENKSKAKNAKDLPKLNQGQFIELCKTMYNMFSEDPNEQELYHATAAVTSLLL
EIGEVGKLFAPQPAKEGGGGGSGPAGHQGLPGSVLFPKKGPSQPYVPEAAEPLPASLAGA
SEEHSLGGQMEDIKLEDSSPRDHGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHC
EDIGEDTVLVRSGQGTAALPRSTSLDRDWAITFEQFLASLLTEPALVKYFDKPVCMMARI
TSAKNIRMMGKPLTSISDYEISALSG
Download sequence
Identical sequences F1MS95
ENSBTAP00000029786 ENSBTAP00000029786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]