SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029967 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029967
Domain Number 1 Region: 17-161
Classification Level Classification E-value
Superfamily EF-hand 6.91e-42
Family Calmodulin-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029967   Gene: ENSBTAG00000022209   Transcript: ENSBTAT00000029979
Sequence length 163
Comment pep:known chromosome:UMD3.1:29:46042201:46046958:-1 gene:ENSBTAG00000022209 transcript:ENSBTAT00000029979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCAKRPRHRAPKDRELRPEEIEELQAAFQEFDRDRDGYIGYQELGACMRTLGYMPTEM
ELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGCISLGEL
RAALKALLGERLSQREVDEILRDIDLNGDGLVDFEEFVRMMSR
Download sequence
Identical sequences Q9N1Q9
ENSBTAP00000029967 NP_776680.1.59421 NP_776680.1.76553 ENSBTAP00000029967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]