SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030121 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030121
Domain Number 1 Region: 382-648
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-77
Family Protein kinases, catalytic subunit 0.000000000286
Further Details:      
 
Domain Number 2 Region: 3-168
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-52
Family Pleckstrin-homology domain (PH domain) 0.0000000359
Further Details:      
 
Domain Number 3 Region: 251-378
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-33
Family SH2 domain 0.000041
Further Details:      
 
Domain Number 4 Region: 200-273
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-19
Family SH3-domain 0.000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030121   Gene: ENSBTAG00000019250   Transcript: ENSBTAT00000030136
Sequence length 659
Comment pep:known chromosome:UMD3.1:X:55171775:55205681:-1 gene:ENSBTAG00000019250 transcript:ENSBTAT00000030136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVILESIFLKRSQQKKKTSPLNFKKRLFLLTVQKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSETEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPVSTSELKKVVALYDYMPMNANDLQLHKGNE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYAIMYSCWHEKADERPTFKILLSNILDVMDEES
Download sequence
Identical sequences L8I8R9 Q3ZC95
NP_001029761.1.59421 NP_001029761.1.76553 XP_005227848.1.76553 XP_005901083.1.15283 XP_014335362.1.15283 ENSBTAP00000030121 ENSBTAP00000030121 9913.ENSBTAP00000030121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]