SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030179 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030179
Domain Number 1 Region: 32-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.04e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1045-1157
Classification Level Classification E-value
Superfamily E set domains 3.14e-37
Family Filamin repeat (rod domain) 0.00000487
Further Details:      
 
Domain Number 3 Region: 1333-1447
Classification Level Classification E-value
Superfamily E set domains 3.14e-34
Family Filamin repeat (rod domain) 0.000033
Further Details:      
 
Domain Number 4 Region: 1536-1644
Classification Level Classification E-value
Superfamily E set domains 5.4e-33
Family Filamin repeat (rod domain) 0.0000066
Further Details:      
 
Domain Number 5 Region: 458-574
Classification Level Classification E-value
Superfamily E set domains 1.07e-32
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 6 Region: 1439-1546
Classification Level Classification E-value
Superfamily E set domains 3.47e-32
Family Filamin repeat (rod domain) 0.0000256
Further Details:      
 
Domain Number 7 Region: 1145-1255
Classification Level Classification E-value
Superfamily E set domains 4.4e-31
Family Filamin repeat (rod domain) 0.0000673
Further Details:      
 
Domain Number 8 Region: 1863-1958
Classification Level Classification E-value
Superfamily E set domains 6.21e-31
Family Filamin repeat (rod domain) 0.00000382
Further Details:      
 
Domain Number 9 Region: 2039-2141
Classification Level Classification E-value
Superfamily E set domains 8.53e-31
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 10 Region: 672-780
Classification Level Classification E-value
Superfamily E set domains 3.78e-30
Family Filamin repeat (rod domain) 0.00042
Further Details:      
 
Domain Number 11 Region: 851-972
Classification Level Classification E-value
Superfamily E set domains 8.28e-30
Family Filamin repeat (rod domain) 0.00034
Further Details:      
 
Domain Number 12 Region: 1243-1354
Classification Level Classification E-value
Superfamily E set domains 8.67e-29
Family Filamin repeat (rod domain) 0.000013
Further Details:      
 
Domain Number 13 Region: 2236-2331
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 14 Region: 2430-2522
Classification Level Classification E-value
Superfamily E set domains 5.14e-26
Family Filamin repeat (rod domain) 0.0000111
Further Details:      
 
Domain Number 15 Region: 1633-1744
Classification Level Classification E-value
Superfamily E set domains 1.22e-25
Family Filamin repeat (rod domain) 0.0000663
Further Details:      
 
Domain Number 16 Region: 380-480
Classification Level Classification E-value
Superfamily E set domains 3.74e-25
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 17 Region: 279-375
Classification Level Classification E-value
Superfamily E set domains 4.54e-25
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 18 Region: 2333-2427
Classification Level Classification E-value
Superfamily E set domains 3.14e-24
Family Filamin repeat (rod domain) 0.0000116
Further Details:      
 
Domain Number 19 Region: 565-666
Classification Level Classification E-value
Superfamily E set domains 3.74e-24
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 20 Region: 769-870
Classification Level Classification E-value
Superfamily E set domains 2.49e-23
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 21 Region: 2159-2252
Classification Level Classification E-value
Superfamily E set domains 4.54e-21
Family Filamin repeat (rod domain) 0.0000115
Further Details:      
 
Domain Number 22 Region: 959-1065
Classification Level Classification E-value
Superfamily E set domains 2.14e-20
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 23 Region: 1964-2062
Classification Level Classification E-value
Superfamily E set domains 8.01e-18
Family Filamin repeat (rod domain) 0.0000979
Further Details:      
 
Domain Number 24 Region: 1799-1878
Classification Level Classification E-value
Superfamily E set domains 3.67e-17
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 25 Region: 2509-2546,2587-2647
Classification Level Classification E-value
Superfamily E set domains 0.00000000000002
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030179   Gene: ENSBTAG00000011190   Transcript: ENSBTAT00000030194
Sequence length 2648
Comment pep:known_by_projection chromosome:UMD3.1:X:40310757:40332714:-1 gene:ENSBTAG00000011190 transcript:ENSBTAT00000030194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHSRAGQSAAGAVLGIGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAAGAGMGEVEVV
IQDPAGQKGTVEPQLEARGDSTYRCSYQPSVEGVHMVHVTFAGVPIPRSPYTVTVGQACN
PGACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYG
FEYYPMIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVV
EAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPF
MADIRDAPQDFHPDRVKARGPGLEKTGVAVNKSAEFTVDAKHGGKAPLKVQVQDNEGCPV
EATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGV
AKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYT
PRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELSKPTHFTVNT
KAAGKGKLDVQFSGPAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGINVTYGGDAIPKS
PFSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVLSKIVGPSGAAVPCK
VEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFSLEAVPPTKPSKVKAFGPGLQG
GSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINIL
FADTHIPGSPFKAHVVPCFDPSKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRS
EAGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGIQ
CYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKV
EYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVE
TRTRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYVPYEAGTYSLNVTYGGHQVPGSP
FKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGMAPLQVKVQGPKGLVEPV
DVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNT
TGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYT
ILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTK
AAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQ
VTALAGDQPTAQPSLRPQQLAPPYTYAQGGQQTWAPERPLVGVNGLDVSSLRPFDLVIPF
TIKKGEVTGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQ
FYVDYVNCGHVTAYGPGLTHGVVNKPAIFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQD
GTCSVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISE
TDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVMKNGQHVASSPIPV
VISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDL
EDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVG
SHCDLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYK
GQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEG
PSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTV
SSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPREN
GIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGITGSPAEFIVNTSNA
GAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIAGSPFKARVT
GEPGARWLLHTPLPXKSSFTVDCSKAGGCAGPSPSKNGRLERKAERPCLGKNGVLAVFKK
GCHSKTGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPG
SPYRVLVP
Download sequence
Identical sequences F1N169
ENSBTAP00000030179 ENSBTAP00000030179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]