SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030261 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030261
Domain Number 1 Region: 64-308,416-477
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-41
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030261   Gene: ENSBTAG00000014122   Transcript: ENSBTAT00000030276
Sequence length 486
Comment pep:known chromosome:UMD3.1:29:29991454:29999118:1 gene:ENSBTAG00000014122 transcript:ENSBTAT00000030276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRALRLRLGPCLSGRGLGTYRRGSTLDWDGKVSEIKKKIQSIFPGGAWNPLYDTSHLP
PERSDVVIVGGGVLGLSVAYWLKRLEKQQGAIRVLVVERDHTYARASTVLSVGGIRQQFS
LPQNVQLSLFSAEFLRNINEYLAVVDDPPLDLQFNPSGYLLLASEEGAAIMERNVKMQRQ
EGAKVCLMSPEQLQKKFPWINTEGVALASYGLENEGWFDPWCLLQGLRRKLQSMGVLFCQ
GEVTRFISSSSHMETASGEQLTLKRIHEVHVKMDHSQEFQPVECAIVVNAAGAWSGQIAE
LAGVGNGPPGTMQGTKLPVEPRKRYVYLWHCPQGPGLEAPLVADPSGAYFRREGLGNNYV
GSCSPTEEEEPDPGNLEVDYDFFQEKVWPRLAQRVPAFETLKVRSAWAGYYDYNTFDQNG
VVGPHPLVVNMYFATGFSGHGLQQAPAVGRAVAEMVLEGHFQTINLSPFLFSRFYFGEKA
QEHCIL
Download sequence
Identical sequences Q5EA45
NP_001029543.2.59421 NP_001029543.2.76553 ENSBTAP00000055565 ENSBTAP00000030261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]