SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030443 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030443
Domain Number 1 Region: 921-1199
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.85e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000136
Further Details:      
 
Domain Number 2 Region: 348-531
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000369
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 3 Region: 533-715
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000584
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 4 Region: 725-814
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000279
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030443   Gene: ENSBTAG00000006256   Transcript: ENSBTAT00000030462
Sequence length 1221
Comment pep:known_by_projection chromosome:UMD3.1:5:94770904:94881418:-1 gene:ENSBTAG00000006256 transcript:ENSBTAT00000030462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGKLSQYNFNENNLKLDLHFLFLCFLKQDATTFHVTVRDDNSIAVSLEASDIMSPSSVYV
VKITGESKNYFFEFEEFNSTLPPPIIFKANYHGLYYIITLVVVNGNVVTKPSRSITVLTK
PLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTV
FNHWLPGICYSNITFQLVSEANFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNK
NNWEEESGSFPEESFMRSQDTTGKGKVFHFTDDTPEIPSGNISSGWPDFNSSDFETTSQP
YLWDSASATPESEDEFVSVLPTEYENNSTLSDMEKSASSSFSSFPVQMILSWLPPKPPTA
FDGFHIHIEREENFTEYLTVDEEAHEFVADLKEPGKYKLSVTTFSSSGSCETRNSQSAKS
LSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSPQENYNGTIVSVVSLTCQKQKE
SQRLEKQYCTQVNSSKSIIENLVPGAQYQVVMYLRKGPLIGPPSDPVTFAIVPTGIKDLM
LYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPTTMTSEWTTYYEIAATVSLTASVRIAN
LLPAWYYNFRVTMVTWGDPELSCCDSSTISFITAPVAPEITSVEYFNSLLYISWTYGDDT
TDLSHSRMLHWMVVAEGKKKIKKSVTRNVMTAVLSLPPGDIYNLSVTACTERGSNTSMLR
LVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQVGSSQEAKLQEPISVSSHV
VTISSLLPATAYNCSVTSFSHDSPSVPTFIAISTMVTEMNPNVVVISVLAILSTLLIGLL
LVTLIILRRKHLQMARECGAGTFINFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLL
AFYINPWSKNGLKKRKLTKQSPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHF
AADLPLNRCKNRYTNILPYDFSRVRLISMNEEEGADYINANYIPGYNSPQEYIATQGPLP
ETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMMSEEEQDD
WACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHKVRQQAMKSKGPMIVH
CSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLM
WMKKKQQFCISDVIYENVSNS
Download sequence
Identical sequences F1N008
ENSBTAP00000030443 ENSBTAP00000030443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]