SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030466 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030466
Domain Number 1 Region: 97-253
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-31
Family AlaX-like 0.018
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000847
Family AlaX-M N-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030466   Gene: ENSBTAG00000015136   Transcript: ENSBTAT00000030485
Sequence length 444
Comment pep:known chromosome:UMD3.1:19:43635376:43644586:-1 gene:ENSBTAG00000015136 transcript:ENSBTAT00000030485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRCQRDSYAREFTTTVVSCRPAELHTEESNGKKEVLSGFQVVLEDTLLFPEGGGQPDD
RGTINDISVLRVTRRGTQADHFTQTPLTPGTEVQVRVDWERRFDHMQQHSGQHLITAVAD
DLFGLKTTSWELGRLRSVIELDSPTVTAEQVAAIERSVNEKIRDRLPVNVRELSLDDPEV
EQVRGRGLPDDHAGPIRVVTIQSVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIF
LAGNRVLKWMERSHGIEKALTALLKCGAEDHVEAVKKLQNSSKLLQKNNLNLLRDLAVHI
AHSLRNSPDWGGVITLHRKGGGEASWRSWAACNFPAPFAAWSQVCALCFRKDGDSEFMNI
IANEIGSEETLLFLTVGDEKGAGLFLLAGPAEAVETLGPRVSEVLEGKGAGKKGRFQGKA
TKMSRRAEVQALLQDYISTQSAEE
Download sequence
Identical sequences F1MZR1
ENSBTAP00000030466 XP_005909235.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]