SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030561 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030561
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.66e-81
Family STAT DNA-binding domain 0.000000341
Further Details:      
 
Domain Number 2 Region: 215-329
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-43
Family SH2 domain 0.0000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030561   Gene: ENSBTAG00000007867   Transcript: ENSBTAT00000030584
Sequence length 331
Comment pep:known chromosome:UMD3.1:2:79939485:79969187:-1 gene:ENSBTAG00000007867 transcript:ENSBTAT00000030584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PELNYQVKVKASIDKNASTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRHLQPKEMKSS
AGNKGNEGCHMVTEELHSITFETQICLYGLTIDLETCSLPVVMISNVSQLPNAWASIIWY
NVSTNDSQNLVFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEKLTVQSSYND
GHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSKEKERLLLKDK
MPGTFLLRFSESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMA
ENIPENPLKYLYPDIPKDKAFGKHYSSQPCE
Download sequence
Identical sequences F1N0R2
ENSBTAP00000030561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]