SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030624 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030624
Domain Number 1 Region: 71-167
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 206-253
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000107
Family SOCS box-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030624   Gene: ENSBTAG00000022622   Transcript: ENSBTAT00000030652
Sequence length 254
Comment pep:known chromosome:UMD3.1:22:50320205:50325617:1 gene:ENSBTAG00000022622 transcript:ENSBTAT00000030652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCVQGLCPLLAVEQIGQRPLWAQSLELPQQVMQPLSAGAFLEEAVEESPAQPEREPKV
VDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDLAT
TPALPTPKEDAPGDPALPATAVHLKLVQPFVRRSSTRSLQHLCRLVINRLVVDVDCLPLP
RRMADYLRQYPFQL
Download sequence
Identical sequences Q2HJ53
NP_001040051.1.59421 NP_001040051.1.76553 ENSBTAP00000030624 ENSBTAP00000030624 9913.ENSBTAP00000030624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]