SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031167 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031167
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 7.78e-51
Family C-type lysozyme 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031167   Gene: ENSBTAG00000022971   Transcript: ENSBTAT00000031211
Sequence length 147
Comment pep:novel chromosome:UMD3.1:5:44421169:44426117:1 gene:ENSBTAG00000022971 transcript:ENSBTAT00000031211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLILGLLLLSVAVQGKTFERCELARTLKNLGLAGYKGVSLANWMCLAKGESGYNTQA
KNYSPGFKSTDYGIFQINSKWWCNDGKTPKAVNGCGVSCSALLKDDITQAVACAKKIVSQ
LGLTAWVAWKNKCQNRDLTSYVQGCRV
Download sequence
Identical sequences G1K230
ENSBTAP00000031167 ENSBTAP00000031167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]