SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031268 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031268
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.06e-41
Family Dual specificity phosphatase-like 0.0000437
Further Details:      
 
Domain Number 2 Region: 197-344
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.06e-39
Family Dual specificity phosphatase-like 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031268   Gene: ENSBTAG00000023039   Transcript: ENSBTAT00000031313
Sequence length 351
Comment pep:known chromosome:UMD3.1:28:31044242:31057065:-1 gene:ENSBTAG00000023039 transcript:ENSBTAT00000031313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDEVWPNLYIGDAATANNRFELWKLGITHVLNAAHGGLYCQGSPDFYGSSVSYLGVPAHD
LPEFDISVYFSSAADFIHRALSTPGAKVLVHCVVGVSRSATLVLAYLMLRQQLSLRQAVI
TVRERRWVFPNRGFLHQLCRLDQQLNSNQKIETASMRKLAEKATQIPAPDPRTWPSMNEA
PAPKRHQCIQQGSANKDHINEVWPNLFLGDAYAARDKKKLTQLGITHVVNVAAGKFQVDT
GAKFYRGMPLEYYGIEADDNPFFDLSVYFLPVARYIRSALSVPQGRVLVHCAMGVSRSAT
VVLAFLMICENMTLVEAIQTVQAHRDICPNSGFLRQLQVLDNRLGRETGRL
Download sequence
Identical sequences F1MG88
ENSBTAP00000031268 ENSBTAP00000031268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]