SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031537 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031537
Domain Number 1 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000257
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 685-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000505
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 571-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000002
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 474-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000371
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 613-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000456
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 382-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000606
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031537   Gene: ENSBTAG00000002668   Transcript: ENSBTAT00000031586
Sequence length 761
Comment pep:known_by_projection chromosome:UMD3.1:X:74973931:74999240:-1 gene:ENSBTAG00000002668 transcript:ENSBTAT00000031586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGGGSLGLHTSDSRMAHTMIMQDFVAGMTGTAHIDGDHIVVSVPEAVLVSDVVTDGGI
TLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITE
TVRVPEQVFVADLVTGPDGHLEHVVQDCVSGVDSPTVVSEEVLVTNSDTETVIQAAGGVP
GSTVTIKTEDDDDDDVKSTSEDYLMISLDDVGEKLEHMGNTPLKISSDGSQEDVKEDGFG
SEVIKVYIFKAEAEDDVEIGGTEIVTESEYTNGHSVAGVLDQSRMQREKMVYMAVKDSSQ
EEDDIRDERRVSRRYEDCQSSGNTLDSTLENRSSTAAQYLQICDSINTNKVLKQKTKKRR
RGETRQWQTAVIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCD
FTTNKKVSFHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKMHKCKY
CDYETAEQGLLNRHLLAVHSKNFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQYCVF
RCADQSNLKTHIKSKHGNNLPYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHCDHKST
NSSDLKRHIISVHTKDFPHKCEVCDKGFHRPSELKKHSDIHKGRKIHQCRHCDFKTSDPF
ILSGHILSVHTKDQSLKCKRCKRGFRQQNELKKHMKTHSGRKIYQCEYCEYSTTDASGFK
RHVISIHTKDYPHRCEFCKKGFRRPSEKNQHIMRHHKEALI
Download sequence
Identical sequences G3X7I7
NP_001192854.1.59421 NP_001192854.1.76553 XP_010820110.1.76553 XP_010820111.1.76553 XP_010820112.1.76553 ENSBTAP00000031537 ENSBTAP00000031537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]