SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031726 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031726
Domain Number 1 Region: 32-279
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-70
Family Eukaryotic proteases 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031726   Gene: ENSBTAG00000015129   Transcript: ENSBTAT00000031780
Sequence length 280
Comment pep:known chromosome:UMD3.1:18:57448225:57454197:-1 gene:ENSBTAG00000015129 transcript:ENSBTAT00000031780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRHLHLSAASGAQGGLGKLLLLPLLVAQFWVSEALLLPANDTSSNFVASGAPCAHGSQ
PWQVSLFNGLSFHCAGVLVDRSWVLTAAHCGNNKPLWARVGDDHLLLLQGEQLRRTSRPI
VHPKYQQGSGPILPRRTDEHDLMLLKLGRPVVPGPRVRPLRLPFRCTQPGDQCQIAGWAT
TSSRRVKYNKGLSCSRVTILSPKECEVFYPGVITSNMMCAGLDQGQDPCQSDSGGPLVCD
ETLQGILSWGVYPCGSAQHPAVYTQICKYRSWIEKTIRSN
Download sequence
Identical sequences Q0VCZ4
ENSBTAP00000031726 NP_001069358.1.59421 NP_001069358.1.76553 XP_005219356.1.76553 XP_005219357.1.76553 XP_019834002.1.53367 XP_019834003.1.53367 ENSBTAP00000031726 9913.ENSBTAP00000031726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]