SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031823 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031823
Domain Number 1 Region: 166-321
Classification Level Classification E-value
Superfamily EF-hand 3.14e-26
Family Calmodulin-like 0.035
Further Details:      
 
Domain Number 2 Region: 72-193
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000199
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031823   Gene: ENSBTAG00000021799   Transcript: ENSBTAT00000031877
Sequence length 328
Comment pep:known chromosome:UMD3.1:18:56422333:56430760:1 gene:ENSBTAG00000021799 transcript:ENSBTAT00000031877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWPPSLLLLLLLLRRGAQGKPSPDAGPHGQGRVHHAAPLSEAPHDDAHGNFQYDHEAFL
GREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRSWIAHTQQRHIRDSVSA
AWNTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGD
SMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYTAEPGEEEPA
WVQTEREQFRDFRDLNKDGKLNGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKA
EILGNWNMFVGSQATNYGEDLTRHHDEL
Download sequence
Identical sequences Q2KJ39
NP_001039725.1.59421 NP_001039725.1.76553 ENSBTAP00000031823 9913.ENSBTAP00000031823 ENSBTAP00000031823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]