SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031879 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031879
Domain Number 1 Region: 121-632
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.13e-158
Family Calponin-homology domain, CH-domain 0.00000000281
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily EF-hand 4.89e-17
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031879   Gene: ENSBTAG00000011613   Transcript: ENSBTAT00000031933
Sequence length 639
Comment pep:known chromosome:UMD3.1:X:71709928:71806530:1 gene:ENSBTAG00000011613 transcript:ENSBTAT00000031933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKLID
FSNSVKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQ
FVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLG
VNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGK
HPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVSWVNRT
LNEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGTLTEDDKHNNAKYAVS
MARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences F1MSB7 L8IFT9
ENSBTAP00000031879 ENSBTAP00000050406 9913.ENSBTAP00000031879 XP_005898591.1.15283 XP_006054316.1.26621 XP_020761214.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]