SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032539 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032539
Domain Number 1 Region: 26-196
Classification Level Classification E-value
Superfamily Nudix 1.69e-25
Family MutT-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032539   Gene: ENSBTAG00000007184   Transcript: ENSBTAT00000032609
Sequence length 238
Comment pep:known chromosome:UMD3.1:18:4990463:5003016:1 gene:ENSBTAG00000007184 transcript:ENSBTAT00000032609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPGPPQEPGRNSLIDDAKARLKKHDCGTEYSHCSSNKCSILLPLLAKDGKLYLLFTLR
SEKLRRSPGEVCFPGGKCEPTDVDDVATALREAQEEVGLRPHQVEVVCCLMPLPFDKDMW
ITPVVGFIDSNFEARPNPDEVKNVFLVPLEYFLRPRVYHQSHVTRCGRRVIVHCFEYTDP
EDGVTYCIRGLTARCAVFIALVILGEKPSFEVDFNLSDLIPPSEESFLKPQKHALSKL
Download sequence
Identical sequences A8E660
ENSBTAP00000032539 9913.ENSBTAP00000032539 ENSBTAP00000032539 NP_001103258.1.59421 NP_001103258.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]