SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032879 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032879
Domain Number 1 Region: 32-391,432-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032879   Gene: ENSBTAG00000014313   Transcript: ENSBTAT00000032952
Sequence length 581
Comment pep:known_by_projection chromosome:UMD3.1:26:19334011:19359393:-1 gene:ENSBTAG00000014313 transcript:ENSBTAT00000032952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTCGRGLRRAVGASPRPTWRRALLDTRGRLKPEYDAVVVGAGHNGLVAAAYLQRFGVNT
AVFERRHVIGGAAVTEEIVPGFKFSRASYLLSLLRPQIYSELELKKHGLRLHLRNPYSFT
PMLEEGTGGKVPRSLLLGTDMVENQKQIAQFSKKDAQAFPKYEAFMDRLALAIDPLLDSA
PVDLEAFQRGSLLQRLKSLSTLKPLWQAGCILGAQLPQYYQVLTAPAAKVLDQWFESEPL
KATLATDAVIGAMTNPYIPGSGYVLLHHVMGSLEGVRGAWGYVQGGMGALSDAIASSATA
HGVSIFTEKTVAKVQVSSGGRVQGVVLQDGSEVRSKVVLSNASPQITFLKLTPQEWLPEE
FVARIAQLDTKSPVTKINVAVNRLPDFLAAPNTPGDQPLPHHQCSIHLNCEDTLLVHQAF
EDTLDGLPSKRPLIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQQRNTYA
DRVFDCIEAYAPGFKGSVVGRDILTPPDLERVFGLPGGNIFHCAMSLDQLYFARPVPLHS
SYCSPLRGLYLCGSGAHPGGGVMGAAGRNAAHVVFRDLRSM
Download sequence
Identical sequences F1MN72
9913.ENSBTAP00000032879 ENSBTAP00000032879 ENSBTAP00000032879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]