SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032976 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032976
Domain Number 1 Region: 177-279
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-21
Family SH2 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032976   Gene: ENSBTAG00000020828   Transcript: ENSBTAT00000033051
Sequence length 297
Comment pep:known_by_projection chromosome:UMD3.1:11:49390250:49396081:-1 gene:ENSBTAG00000020828 transcript:ENSBTAT00000033051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YELPPCEALLRHLTPAHLSGTEEDSLYLDHSAPLGPPTSPLPPPQPQPEMVHSLPARPTP
AHHFPPKAAPSPLEALKQSWPFGRQELGEPARAVPGPLKEPDEDIYVECEPSPVPAFTQT
LSSPVLTAPVPLPRISMGPRPTITPQEAQNGASKATSEAERRTSLSSVAATQNTSGAQEG
NLLGQPWYSGNCDRHAAESALLRCQKDGAYTVRPSSGPRGTQPFTLAVLLHGRVFNIPIR
RLADGRHYALGREGRNHEELFSSVAAMVQHYMQHPLPLLDRQSGSRQLTCLLFPTKP
Download sequence
Identical sequences F1MPZ8
ENSBTAP00000032976 9913.ENSBTAP00000032976 ENSBTAP00000032976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]