SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033188 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033188
Domain Number 1 Region: 2-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-84
Family Calponin-homology domain, CH-domain 0.00000136
Further Details:      
 
Domain Number 2 Region: 1440-1664
Classification Level Classification E-value
Superfamily Plakin repeat 6.41e-53
Family Plakin repeat 0.0000967
Further Details:      
 
Domain Number 3 Region: 1668-1846
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-49
Family Plakin repeat 0.00034
Further Details:      
 
Domain Number 4 Region: 2295-2487
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-39
Family Plakin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 6493-6643
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-27
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 6100-6215
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 2588-2691
Classification Level Classification E-value
Superfamily Plakin repeat 6.54e-25
Family Plakin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 5960-6105
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-25
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 9 Region: 5290-5436
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 239-355
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-24
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 11 Region: 4744-4901
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-23
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 12 Region: 6603-6729
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-22
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 13 Region: 6296-6434
Classification Level Classification E-value
Superfamily Spectrin repeat 6.84e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 5626-5774
Classification Level Classification E-value
Superfamily Spectrin repeat 3.38e-21
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 15 Region: 6712-6839,6866-6897
Classification Level Classification E-value
Superfamily Spectrin repeat 3.7e-21
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 16 Region: 5179-5302
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-21
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 17 Region: 7010-7092
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.24e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 18 Region: 5399-5555
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 2479-2583
Classification Level Classification E-value
Superfamily Plakin repeat 7.59e-17
Family Plakin repeat 0.0022
Further Details:      
 
Domain Number 20 Region: 6179-6286
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-16
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 21 Region: 5881-5998
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-16
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 22 Region: 3885-3999
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-16
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 23 Region: 4958-5118
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000114
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 24 Region: 6921-7001
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000128
Family Polcalcin 0.057
Further Details:      
 
Domain Number 25 Region: 4457-4575
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000252
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 26 Region: 1156-1282,1309-1335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000288
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 27 Region: 4634-4755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000407
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 28 Region: 3721-3842
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000178
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 29 Region: 4344-4464
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000406
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 30 Region: 611-713
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000432
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 31 Region: 3964-4095
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000158
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 32 Region: 4181-4284
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000119
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 33 Region: 5773-5882
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000132
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 34 Region: 3508-3625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000563
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 35 Region: 520-609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000124
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 36 Region: 4059-4178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000523
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 37 Region: 2215-2293
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000732
Family Plakin repeat 0.0019
Further Details:      
 
Domain Number 38 Region: 3343-3493
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000273
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 39 Region: 1353-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000345
Family Spectrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033188   Gene: ENSBTAG00000021024   Transcript: ENSBTAT00000033270
Sequence length 7284
Comment pep:known_by_projection chromosome:UMD3.1:3:107180352:107389223:-1 gene:ENSBTAG00000021024 transcript:ENSBTAT00000033270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDERDRVQKKTFTKWANKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRM
RFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGES
GDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSN
RENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGDGISATE
VDARWQEYQSRVDSLIPWIKQHTILMSDKSFPQNPVELKALYNQYIHFKETEILAKEREK
GRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERLELLLQ
IANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQVDL
QILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPPSTLTTTHLKAE
PLTKVTHSSSTSWFRKPMTRVELVSISSSEDEGNLRFVYELLSWVEEMQMKLERAEWGSD
LPSVELQLEAQQHIHASVEELGSSVKEARLYEGKMSQNFHTSYVETLGKLETQYCKLKET
SSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNISAKKNYFSELTMELEE
KQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHLKENTAYFQF
FSDARDLESFLRNLQDSIKRKYSCDHSTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGR
SKSVVQLKPRSPDHMLKSTISVKAICDYRQIEITICKNDECVLEDNSQRTKWKVISPTGN
EAMVPSVCFLIPPPNKDAMETASRVEQSYQKVMALWHQLHVNTKSLISWNYLRKDLDLVK
TWNLEKLRSSAPGEYHQVMKNLQAHYEDFLQESRDSALFSVADRLRLEEEVEACKTHFQH
LLKSMENEDKEETVAKMYISELKNIRLRLEECEQRLIQRIQSPASSRTDKDARQDNALRI
AEQEHTQADLQQLRADLDAVSMKCNSFLHQSPSGSSVPTLRSELNLLVEKMDHVYGLSTV
YLNKLKTIDVIVRSIQDAELLVKGYEIKLSQEEAVPPDLSALESHRSTLRHWLSDVKDKN
SVFSVLDEEIGKAKIVAEQLSRLTPERNLDLERCQEKGSQLQDRWHRVIAQLETRQSELE
SIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQTELFAEIERNQT
KLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDLRTR
YTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLAKNTQSKATS
PQTKEPTDIEKAILEQQVLAEELTTKREQVSEAVKTSQIFLAKHGHKLSEKEKEQISEQL
NALSKTYHDLCEGSANQLQQLQSQLAQQTEQKGCRAVAGVIDLGTVEIFPIFRAMQKGLV
DQDTGLVLLESQVILSGLIAPETCEKLSLEEGLARNLINPQMYQQLQELQDALSLISRLT
ENKGPLSVAEAIEKKIISEKVGLKILEAHLATGGFSLPNDENCINLEEAFHQGLISAWLH
SGLESHLRSSKNLIDPNTAEKIDLLDLMQRCIVHQESGLKLLPVKQLAGGMVSLKSGRKV
SIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVGEAVRHNLIDQDMACALLIR
QLQTGGIIDTVTGRRLTVDEAVSHDLVSAKIALVILESLWSFMGLLWPESGEILPITDAL
EQGIVSTELAHKILSDRQHIKAVFLPATTEIWSWEKAIENGMLDKSLANNLKSVCIPDVM
PHMQLADSLERGKFNTNPGTAGVLCSTGQTEGATSHNEKLLFQLMTHSYINVRDGQRLLL
LDNELIEALTARGDQTGPPEVFGSGHQRLEAAEKLQEAVNVKMMETFCDELSVRSHEFQF
SSQSKEDADQANCTEAKRKKIVVETEGSSIENPQMDLFVGQQKVGNPNVDTLNVIDKVKS
EFKRQLFGTKKEEQIEVSTRENVNREFLLTVPPEKAEDVTVVEDKNLLSVESLKEEWQIL
RKTSLTCQKEQANTRETEYTPGETGRPLVIPQSKKSQFQVEKTLALESELRSEKDKTVLS
LDKKKALSESPLGRDDHQQSPESHSMAGGSRMMTDKEADGSETSLPCIAASELLEEATLN
TLAAQLVEGGILHEQTGQKLLLSEAVARGVVPSHAAVKLMGKMNMFRGFFDSQTCESLTT
EEVIDEGLMDEKLLHNVLMADKAISGVLDPHAHTLCSVKEAVAIGLLDTQTATRILEGQV
VTGGIIDLKRGKKVSVTLASNLGLVDSADQPELINLEKASKGRDAENTVRGRLISLQMET
TGIMDPDNKAPLTVMQSIDRGLLERDEAIQLLTKQVVDGGIIHHISGMRLSVDNAFKHGI
IDEDLAKELRKVETLSLRQFSHPETKETISLSEAMKLDLVTPDLKREIQEIQAFTGSFVD
LISGQQLTLAEAEKEGRLTNKATLSSEMMNGIIDPESYRIVPYSELVKKCKIDIESGQRY
LEVIPFSDIKDGASDKVLTLSQAIKLGKVDFAAALKVLEAQANAGGIIDPATGKRLTLSS
ALEQKLVDENMVRIIASRQVLDGGIIDIFSNQRVTLKEAIEKRLISPELATIIQEDTFKA
HIEKQDGIEVCEIKKQFLRKEMLIAHSQPAEMSCGKGESEKLSQIENQSAQKNIKVRVSN
GEEAKKSREISLKGLECDDQNKRSSPDAKESLSVIIPSDGKDKSLGQDSETYLQSEICEF
NPKEVASTTMEKNTNEEQEIIVQTEIISHMKQPVSGLDSKEVRENQGGIISEVQESNHET
LDKLLIQQVIQKPVKTTEKGKGGKKIVEEGIKTRGPAALSEEKLNQETISDDRDPSIENQ
CTEITAREKGKATDKGLGFSVVGETEDSSSQMTPKGISIRNQDALTFFNSNQVSESQEII
VGLQSELLSSLIPRPEGLYYQEPVGGVQVADTAPSFTTDRSFQGTTRQETNYHQDSCVTS
KVRQTKDLPFLSNEYKEKSYQEVPFDSTSTVKLEEMRVGSKEVSNLEFSDRKDFHPQDNK
SDHEHGRILESKIVTTQEIPGEESLRMSNLIVTGAEVGSFEGIVTQRVPRVSVSLLPEKL
SREVSQKENTGQQEATISPIPDTSEEERLPPVSCPTMKMDEKTPQEKLRASPGSEQTPLM
TVPGGASVNPEPFRATKNVFTRQLCLEHDEKLVSYLSLLRDIEMRTKQIQPLELNLAELQ
DLLCQAKVLDKELKDLSTVVSQELECVDQIIISQPEEVPAQLLKALEKDAKNLQKSLSSV
SDTWGSRLLHLQSALEVQKTRVLNQYEQLEGRLQDLRAWVGDTHVILNSKEYDSETDAGS
LNHCLQRCEDLKQPMAERKSQLDALAFDIQFLISEHAQDLSPQQNRQMLRLLNEVQRSFQ
DLVEETTAQGNALRDRLQQMEQAAQVKTLQKQQNTCHQKLEDLCSWVGQAERALAGHQGR
ATQQDLSALQKNQSDLKDLQDDIQNHATSFASVVKDTEGFLEENQTKLSPDELTALQEKL
HQAKEQYEALQERTKLAQKELEEVVTSALQQETEKSKAAKELAENRRKIDALLDWVTSVG
SSEGQMEQLSGNLEKGALDTTDGHAGLNEAPEKLDKQCEKLKARHQELLSQQQNFILATQ
SAQAFLDQHGHSLTPEEQQLLQEKLGELKEQYATSLAQSEAELKQVQTLRDELQKFLQDH
REFENWLERSEKELESMHQGGSSPEALPALLKRQGSFSEDVISHKGDLRFVTISGQKVLD
TGNSLDDGREASATGTLVKAKLKDATERYSTLHAECTRLGTHLNMLLGQYQQFQSSADSL
QAWMKACEASVKKLLSDTVASDPGVLQQQFATTKQLQEELAEHQVPVEKLQKVAHDLMEI
EGEPAPDRKHVQETTDSILSHFQHLSSSLAERSALLQKAIAQSQSVQESLDSLLQSIREV
ENNLEEEQVVSLSSGVVQEALATNMKLKQDIARQKSSLEATRDMVTQFMETADSTTAAVL
QGKLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFEHLSEKLQQFMENKSRLLASGNQPD
QDIAHFFQQIQELNLEMEDQQENLDTLEHLVTDLSSCGFALDLSQHQHRVQNLKKDFSEL
QKTIKEREEDASSCQEQLDEFRKLVRIFQKWLKETEGNIPPAETFMSTKELEKQIEHLKD
LLDDWTSKGTLVEEINCKGTSLENLIMEITAPDSQAKTGSILPSVGSSVGSVNGYHTCKD
LTEIQCDMSDINLKYEKLGGVLRERQESLQAVLSRMQEVQKEASSVLQWLESKEEVLKGM
DTSSSPTKTETVRAQAESNKAFLAELEQNSPKVQNVKEALAGLLITYPNSQEAENWKKMQ
EELNSRWERATEVTMARQRQLEESASHLACFQAAESQLRPWLMEKELMMGVLGPLSIDPN
MLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTGPGDASASTSQVQKELQSINEKWIE
LTDKLNSRSNHIDQAVVKSTQYQELLQDLSEKVKAVGQRLSGQSAISTQPEAVKQQLEET
SEIRSDVEQLDQEIKEAQTLCDELSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRMN
RLQAALASTQQFQQMFDELRTWLDDKQSQQAKNRPISAKLEQLQSQLQENEEFQKSLNQH
SGSYEVIVAEGESLLLSVPPGEEKKTLQNQLVELKSHWEELSKKTADRQSRLKDCLQKAQ
KYQWHVEDLVPWIEDCKAKTSDLRVTLDPVQLESHLLRSKAMLSEVEKRRSLLEILNSAA
DILINSSETDEDDIRDEKAGINQNMDSITEELQAKTGSLEEMTQRLKEFQESFKNIEKKV
EGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQTLEPQVDYLRNFTRGLVEDAPDGFDA
SQLLHQAEVAQQEFLEVKQRVNSGCMAMENKLEGIGQFHCRVREMFSQLADLDDELDGMG
AIGRDTDSLQSQIEDVRLFLNKIQALKLDIEASEAECRQMLEEEGTLDLLGLKRELEALS
KQCSKLTERSRARQEQLELTLGRVEDFYQKLKVLNDMTTAAEEGEALQWVVGTEVDVINQ
QLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGKNCDVQGLEHDMEEINARWNTLNKK
VAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQ
RLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLESLESRWTGLLSKATARQKQLEDI
LVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALNEEIVNRKKNVD
QAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQARQLATKFQSTY
EELTGWLREVEEELAASGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLE
LVPWRAREGLDKLVSDANEQYKLVSDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAETK
RKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFGTCGEEQKAVLQ
EKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEETRALIAQLPPPAI
DHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGQMVEEKYQKAENTYAQ
IKEEVRQRALALDEAISQSAQFHDKIEPMLETLESLSSRLRMPPLIPAEVDKIRECISEN
KSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEE
REIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEET
DGLHEELEFIRILGADLIFACGETEKPEVKKSIDEMNNAWENLNKTWRERLEKLEDAMQA
AVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLN
HQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEE
LMSWLTHTEELLDAQRPVSGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESS
AGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLDLTRMETQ
LSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQ
SVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLI
LNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEK
VVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKH
KEFQKTLGGKQPVYDTTIRTGRALKEKTLLPDDTQKLDNLLGEVRDKWDTVCGKSVERQH
KLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKR
TGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVCKQSRLEQALKQAEEF
RDTIHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKKVEEKRVDVSTAVSMGE
VILAACHPDCVTTIKHWITIIRARFEEVLTWAKQHQQRLEAALSELVANAELLEELLAWI
QWAESTLIQRDQDPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKILEPAHA
PFMEKSRGGSRKSLSQPAPPPMPILSQSEAKNPRINQLSGRWQQVWLLALERQRKLNDAL
DRLEELCPELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI
LASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQV
AQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVK
NDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHS
CTSMPSSPATPASGTKVIPSTGRKLKRPTPAFHSSRTSLAGDTSNSSSPASTGAKTNRAD
PKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGSSRRGLN
KPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences F1N6H4
ENSBTAP00000033188 ENSBTAP00000033188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]