SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033385 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033385
Domain Number 1 Region: 23-126
Classification Level Classification E-value
Superfamily Immunoglobulin 5.54e-24
Family V set domains (antibody variable domain-like) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033385   Gene: ENSBTAG00000024242   Transcript: ENSBTAT00000033472
Sequence length 134
Comment pep:known_by_projection chromosome:UMD3.1:4:106625822:106626356:1 gene:ENSBTAG00000024242 transcript:ENSBTAT00000033472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNPTLTCFTVLCLLGAGFLEAEVTQTPGHLVQGKGLEVKMYCVPKKGHIYVFWYQQILTK
EFKFLISFQNDKVLDDKEMPKRFSAECPSNSPCSLKIQSTEPQDSALYFCASSDCTVRNT
GFSSGSRCIIELEQ
Download sequence
Identical sequences F1N5M3
ENSBTAP00000033385 ENSBTAP00000033385 9913.ENSBTAP00000033385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]