SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033594 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033594
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-33
Family FKBP immunophilin/proline isomerase 0.00018
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000223
Family Calbindin D9K 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033594   Gene: ENSBTAG00000007870   Transcript: ENSBTAT00000033684
Sequence length 211
Comment pep:known_by_projection chromosome:UMD3.1:4:66758679:66770727:1 gene:ENSBTAG00000007870 transcript:ENSBTAT00000033684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLWNAVLTLLVTCLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLTIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKNEVKVYLKKEFEKHGAVVNESHH
DVLVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences F1N4S5 L8I9V1 W5PFR3
ENSBTAP00000033594 ENSOARP00000009278 NP_001069859.2.59421 NP_001069859.2.76553 XP_004007981.1.66739 XP_005679315.1.57651 XP_005901464.1.15283 XP_005981282.1.78601 XP_006055725.1.26621 XP_010827617.1.44457 XP_011967647.1.54773 XP_019814382.1.53367 ENSBTAP00000033594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]