SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033686 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033686
Domain Number 1 Region: 523-555,637-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033686   Gene: ENSBTAG00000015547   Transcript: ENSBTAT00000033777
Sequence length 760
Comment pep:known chromosome:UMD3.1:4:49058943:49092515:-1 gene:ENSBTAG00000015547 transcript:ENSBTAT00000033777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPIGNQYVVARPVYSANAFGEDHKKKQRHHKTLLDHLKKLCRCSAQRAKKIAFSSFPI
ASWLPAYRIKEWLLSDIVSGISTGLVAVLQGLAFALLVTIPPGYGLYAAFFPVIIYFFLG
TSRHISVGPFPVLSMMVGAVVVRLTPTDSAADSTFANSSMTNDSSIDEQKVIVAATVTIL
SGIIQLLMGVLRLGFVVIYLSESLISGFTTAAAIHVLVSQLKFMFQLTVPAHTDPFSLFK
VLESVFSQIEKTNIADLVTSLVILVVVFVVKEINQRYKAKLPVPIPIELIVTVIATGVSY
GFDFKRRFNVAVIGEMKPGFQAPIIPSRQTFQDTIGDCFGIAIVGFAVAFSVASVYSLKY
DYPIDGNQELIAMGAGNIFGGSFRGFAASTSLSRSGVQESTGGKTQIAGLISAIIVLIVI
VAIGFLLEPLQKSVLAALALGNLKGMLMQFVEIRRLWRKDKYDCLIWVMTFIFAVVLGLG
LGLAASVAFQLLTIVFRTQFPKCSMLANVGRSNIYKNRKDYSEIYEPEGVKIFRCPSPIY
FANISFFKQKLIDAIGFRPLRILRKRNKALKKIRKLQKKGLLQVTPKGFICTVDGFKDSD
EELDNDKIEELDQPINTKDLPFQIDWNANLPLNIVVPKINLHSLILDFSAVSFLDVSSMR
GLKTILQEFIRIQVDVYIVGTDDDFIEKLKRCEFFDDEVKDSIFFLTIHDAVLHILMKKD
YSTSKFNPSQEVEAKLDDFTINTNGGLRNRECQVPIETKF
Download sequence
Identical sequences F1N207
ENSBTAP00000033686 ENSBTAP00000033686 9913.ENSBTAP00000033686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]