SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033794 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033794
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily EF-hand 3.7e-22
Family S100 proteins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033794   Gene: ENSBTAG00000024437   Transcript: ENSBTAT00000033888
Sequence length 108
Comment pep:known chromosome:UMD3.1:3:17137845:17140530:1 gene:ENSBTAG00000024437 transcript:ENSBTAT00000033888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTPVEESLFQIIHCYHEYAAREGDAETLSLEELKALLMDNVPRFMETLGRKEPYYITQ
LFRAADKNQDNQICFEEFLYILGKLVKDYHLQYHRQLCAHYCTQHSLY
Download sequence
Identical sequences E1BPR8
ENSBTAP00000033794 9913.ENSBTAP00000033794 ENSBTAP00000033794 XP_001254067.1.59421 XP_002686049.1.76553 XP_010855841.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]