SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033941 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033941
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.06e-85
Family Eukaryotic proteases 0.0000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033941   Gene: ENSBTAG00000024496   Transcript: ENSBTAT00000034039
Sequence length 269
Comment pep:known chromosome:UMD3.1:16:53272046:53288451:-1 gene:ENSBTAG00000024496 transcript:ENSBTAT00000034039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRALLLSTLVAGALSCGVPTYPPQLSRVVGGEDARPNSWPWQVSLQYSSSGQWRHTCGG
SLIEQNWVLTAAHCISSSRTYRVVVGRQSLSTVESGSLTIAVSKSVIHEKWNSNQLAQGN
DIALLKLASSVPLTDKIQLGCLPPAGTILPNNYVCYVTGWGRLQSNGALPDILQQGKLLV
VDYATCSQPSWWGSTVKTNMICAGGDGVTSSCNGDSGGPLNCQAANGQWQVHGIVSFGSS
LGCNYYRKPSVFTRVSNYNDWISSVIENN
Download sequence
Identical sequences A7YWU4
XP_019831968.1.53367 ENSBTAP00000033941 9913.ENSBTAP00000033941 ENSBTAP00000033941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]