SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033942 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033942
Domain Number 1 Region: 22-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-84
Family Eukaryotic proteases 0.00000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033942   Gene: ENSBTAG00000024497   Transcript: ENSBTAT00000034040
Sequence length 268
Comment pep:known chromosome:UMD3.1:16:53295217:53302109:-1 gene:ENSBTAG00000024497 transcript:ENSBTAT00000034040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGITVFTTFLAYASSCGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYLRDNTWRHTCG
GTLITPNHVLTAAHCISNTLTYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRN
DIALIKLAETVELSDTIQVACLPEEGSLLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPV
VDYATCSQRDWWGTTVKETMVCAGGDGVISACNGDSGGPLNCQAENGNWDVRGIVSFGSG
LSCNTFKKPTVFTRVSAYIDWINQKLQL
Download sequence
Identical sequences B0JYP7 Q7M3E1
9913.ENSBTAP00000033942 ENSBTAP00000033942 ENSBTAP00000033942 NP_001092435.1.59421 NP_001092435.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]