SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033974 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033974
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily EF-hand 3.87e-19
Family Calmodulin-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033974   Gene: ENSBTAG00000024508   Transcript: ENSBTAT00000034073
Sequence length 141
Comment pep:known_by_projection chromosome:UMD3.1:16:52086276:52086936:-1 gene:ENSBTAG00000024508 transcript:ENSBTAT00000034073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGVSEMFSEEGKGQVKTDELEWLVSLLGINSTKSELASTAKDVDRVKKGFFNCSNLLALM
GLYWEKAQNQEGELRAALCIFDKEARGYIDWDTLKYVLMNVGEPLNEQMMKEADENGDGT
LNYEALRVQGMMTGESFKLVQ
Download sequence
Identical sequences F1N2T7
ENSBTAP00000033974 9913.ENSBTAP00000033974 ENSBTAP00000033974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]