SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034009 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034009
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily EF-hand 1.2e-23
Family S100 proteins 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034009   Gene: ENSBTAG00000012638   Transcript: ENSBTAT00000034108
Sequence length 92
Comment pep:known chromosome:UMD3.1:3:17164142:17165262:1 gene:ENSBTAG00000012638 transcript:ENSBTAT00000034108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLEDHLEGIINIFHQYSVRVGHFDTLNKRELKQLITKELPKTLQNTKDQPTIDKIFQD
LDADKDGAVSFEEFVVLVSRVLKTAHIDIHKE
Download sequence
Identical sequences P79105
ENSBTAP00000034009 9913.ENSBTAP00000034009 NP_777076.1.59421 NP_777076.1.76553 XP_005203669.1.76553 XP_005203670.1.76553 XP_010855744.1.44457 XP_010855745.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]