SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034061 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034061
Domain Number 1 Region: 10-180,282-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.55e-48
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034061   Gene: ENSBTAG00000014439   Transcript: ENSBTAT00000034160
Sequence length 480
Comment pep:known chromosome:UMD3.1:16:35975651:36045361:-1 gene:ENSBTAG00000014439 transcript:ENSBTAT00000034160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSDIQRKNIAIIGGGLVGSLNACFLAKRNFQVDIYEAREDIRVTKSARGRSINLALSY
RGRQALKAIGLEDQVVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSISRENLNKDLLT
AVEKYSNAKVHFGHRLVKCNPEKGVITVLGQDKVPKDVTCDLIVGCDGAFSTVRTYLMKK
PRFDYSQQYIPHGYMELNIPPKNGDYAMEPNYLHIWPRDTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSSDVLDFFQKYFPDSIPLIGKQALVQDFFLLPAQSMISVKCSSFHFKSHCL
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDFSMCLPEFSRLRIPDDHAISDLS
MYNYIEMRAHVNSRWFIFRKNIERLLHAIMPSTFIPLYTMVTFSRIRYHEAVLHWYWQKK
VINGGLFLLGTLIAVSGTYLLMRYKSPSPLDYLRRPSEWVTYFQNTGHVSLISLQVYCDY
Download sequence
Identical sequences E1BN59
ENSBTAP00000034061 ENSBTAP00000034061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]