SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034182 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034182
Domain Number 1 Region: 380-502
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-28
Family SH2 domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034182   Gene: ENSBTAG00000014922   Transcript: ENSBTAT00000034285
Sequence length 507
Comment pep:known chromosome:UMD3.1:8:62466446:62601823:-1 gene:ENSBTAG00000014922 transcript:ENSBTAT00000034285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQAPAAASASCGTAAA
SCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGGEP
GGSQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISP
KHRLIKVESAAGCAGDPPGGACSGGRTWSPTACGGKKLLNKCGASAAEESGAGKKDKVTI
ADDYSDPFDAKNDLKSKTGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYE
PEGQSVDSDSESTISPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGSEKRQS
SPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAEN
LLRLCKECSYLVRNSQTSRHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVI
HYYTTRKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences E1BLY9
9913.ENSBTAP00000034182 NP_001179863.1.59421 NP_001179863.1.76553 XP_019821792.1.53367 ENSBTAP00000034182 ENSBTAP00000034182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]