SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034314 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034314
Domain Number 1 Region: 43-323
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.62e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034314   Gene: ENSBTAG00000024715   Transcript: ENSBTAT00000034419
Sequence length 361
Comment pep:known_by_projection chromosome:UMD3.1:15:79043172:79060806:1 gene:ENSBTAG00000024715 transcript:ENSBTAT00000034419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFGCIFGALVIVAVGGFIFWRRRRKGVKNNDVTFSQIKPKKSKLIKVENFEAYFKKQQAD
SNCGFAEEYEDLKLVGINLPKYAAELAENRGKNRYNNVLPYDVSRVKLSVQTHSTDDYIN
ANYMPGYHSKEDFIATQGPLPNTLKDFWRMVWEKNVYAVVMLTKCVEQGRTKCEEYWPSK
QAQDYGDITVAMTSEIVLPEWTIRDFTVKNTPTSESHPLRQFHFTSWPDHGVPDTTDLLI
NFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFVAIDRLIYQIENENTVDVYGIVYDLRM
HRPLMVQTEDQYVFLNQCVLDIIRSQKDSKVDLIYQNTTAMTIYENLSPITTFGKTNGYI
A
Download sequence
Identical sequences F1MM04
ENSBTAP00000034314 ENSBTAP00000034314 9913.ENSBTAP00000034314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]