SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034710 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034710
Domain Number 1 Region: 105-212
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000169
Family Calmodulin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034710   Gene: ENSBTAG00000024975   Transcript: ENSBTAT00000034826
Sequence length 390
Comment pep:known chromosome:UMD3.1:19:45520281:45526187:-1 gene:ENSBTAG00000024975 transcript:ENSBTAT00000034826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSRGRKTKRSPSAKRTSRPPQKPQRLLTQDPGEEQASRTQKGRLQQCAAFLTRKEPAA
ALATGAEQASQRTRQLKGLEATHTVQSDPQTRSQRGSFADKNLLPLTARQLAAFQDVFKL
FSSSPTGSVDMRSMKAALSNVGVQLSPQEMCEALRQADLDGDGTVSFKDFLGVLTDSHRL
AQCLGKVRNSWAYDPQGLQTLFLEMLFKLMSLGYVPFKSVREVMSYYSKKQRSLRLNASW
KGRSRSHGRSGRSHAGLAFFCQAARLIGLSNAELARSLHGLHKAGACSPYSQIPSLNGGT
QPESHTQSRTPRPDVRLPKSYQPSRPKRAPKSGRLSQGRPLRASAGFASQLLGCMCPSKL
APSPPTLIQKQPFSPSPAYLQRPATKKLYK
Download sequence
Identical sequences E1BJD0
ENSBTAP00000034710 9913.ENSBTAP00000034710 ENSBTAP00000034710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]