SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034915 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034915
Domain Number 1 Region: 867-972
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-30
Family Calponin-homology domain, CH-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034915   Gene: ENSBTAG00000000928   Transcript: ENSBTAT00000035035
Sequence length 974
Comment pep:known_by_projection chromosome:UMD3.1:19:34124435:34195907:-1 gene:ENSBTAG00000000928 transcript:ENSBTAT00000035035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSVTATKRTGIPAPRELAVTVSRDRTVPRGPSNSRKVTTSPTSSSTPTPTKHVRAAPPR
PRPEHEGAEKAVLESQVRELLAEAKEKDSEINRLRSELKKWMEKRTQDSEGGDALDSSVD
GASVLPGDSEPLIRALEEKNKSFQKELAELEEENRALKEKLTYFEHSPDSEGGASHTGDS
SCPTSVTQESSFGSPTGNEALSEIDVYRKNPHEGALRTSGSSSSDVTKASLSPDASDFEH
IPADTLGPLSPAGSLVKSSKCSAAGSSPNTASELSLASLAEKIHRMEENQHSTAEELQAT
LQELSDQQQMVQELTAENEKLADEKTLLETSFHQHRERAEQLSQENEKLMTLLQERVKGE
EPGAQEGKILELEQKCTEILEQGRFEREKLLSIQQQLTCRLRAVEEEHRSALELVRHLQE
VNGELTTRLELEQHSGGPTAEIPAARQLPVEGLQVENGSLQASLENEEQKTGGASPLGPM
AEGCDVQEMLTVARAEKDQLEQSCSELRQELLKAHGEVKRVSSLLAKVEKDYSYLKEICD
HQAEQLSRTSLKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKLHNNQLISELESSVM
KLEEQKSDLERQLKTLTKQIKDETEEWRRFQADLQTAVVVANDIKVEAQQELRAVKRRLL
EEEEKNARLQKALGDAQARGRILTSQKTQKPVKEEPEPSEADAPGRWPSAYVNRTPPTPS
ESVTTVKSLIKSFDLGRPGGAGQNISVHKTPRSPLSGIPVRTPPAAAVSPMQRHSAFSSA
RPASKGEIQRLDLPDLPLSDLLKGRAEDLKPNPYLRKSPSLESLSRPPSLGFGGSRLLGT
SPAGWKPQSKLSVERRDPLAALAREYGGSKRNALLRWCQRKTEGYANIDITNFSSSWSDG
LAFCALLHTYLPAHIPYQELNSQEKKRNLLLAFEAAESVGIKPSLELSELLHTDRPDWQS
VMQYVAQIYKYFET
Download sequence
Identical sequences F1MEN2
ENSBTAP00000034915 ENSBTAP00000034915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]