SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034949 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034949
Domain Number 1 Region: 9-175
Classification Level Classification E-value
Superfamily EF-hand 1.94e-56
Family Calmodulin-like 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034949   Gene: ENSBTAG00000025088   Transcript: ENSBTAT00000035069
Sequence length 202
Comment pep:known chromosome:UMD3.1:19:29653157:29661163:-1 gene:ENSBTAG00000025088 transcript:ENSBTAT00000035069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEA
DPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKLKEKKL
Download sequence
Identical sequences P21457
NP_776590.1.59421 NP_776590.1.76553 ENSBTAP00000034949 2i94_A ENSBTAP00000034949 2i94A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]