SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034966 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034966
Domain Number 1 Region: 352-613
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-77
Family Protein kinases, catalytic subunit 0.000000000325
Further Details:      
 
Domain Number 2 Region: 6-146
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-45
Family Pleckstrin-homology domain (PH domain) 0.0000506
Further Details:      
 
Domain Number 3 Region: 234-382
Classification Level Classification E-value
Superfamily SH2 domain 1.31e-32
Family SH2 domain 0.00000163
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-17
Family SH3-domain 0.0000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034966   Gene: ENSBTAG00000000306   Transcript: ENSBTAT00000035086
Sequence length 620
Comment pep:known chromosome:UMD3.1:7:70911162:70973272:1 gene:ENSBTAG00000000306 transcript:ENSBTAT00000035086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKTSLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDIIIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWLDGRWRCCAQMEKLAVGCAQYDPTKNASKKPLPPTPEDNRRSLRELEETVVIALY
DYQTNDPQELMLQRNEEYYLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKNISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCSWRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDITTGFRLYKPRLASQHIYQIMNHCWKEKPE
DRPPFSRLLSQLAEIAELGL
Download sequence
Identical sequences A7Z039
NP_001098858.1.59421 NP_001098858.1.76553 XP_010853583.1.44457 XP_019820866.1.53367 9913.ENSBTAP00000034966 ENSBTAP00000034966 ENSBTAP00000034966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]